PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa000376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 427aa    MW: 49046.7 Da    PI: 8.6636
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58686775PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.52e-35364422260
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                kek lkcprCdstntkfCyynnysl+qPr+fCk+CrryWt  G+lrnv vGgg+rk k+
  Lsa000376 364 KEKPLKCPRCDSTNTKFCYYNNYSLTQPRHFCKSCRRYWTLNGSLRNVRVGGGSRKPKR 422
                7899****************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.200.201.6E-261291No hitNo description
SuperFamilySSF561124.71E-7015306IPR011009Protein kinase-like domain
PROSITE profilePS5001133.64425308IPR000719Protein kinase domain
SMARTSM002201.7E-2825298IPR000719Protein kinase domain
PfamPF000692.8E-4328296IPR000719Protein kinase domain
PROSITE patternPS0010703156IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:1.10.510.102.0E-3992296No hitNo description
PROSITE patternPS001080147159IPR008271Serine/threonine-protein kinase, active site
ProDomPD0074782.0E-26361422IPR003851Zinc finger, Dof-type
PfamPF027015.2E-30366422IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.447368422IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEAFMEEFQH LKIQLQEINL ATTNFDMNNV IGKGGFGMVY EGVLSHSKRQ SMVAFKRLNR  60
SNGQGNCEFL KEIMMLSRYT HENLISLLGF CDEDDEKILV YEHAYNGSLD RHLSNTAITW  120
MQRLKICLGA AMGLCYLHDP KETHQRVLHR DIKSSNILLD ENWNAKVSDM GLSKIGLANQ  180
QHTALVSNVV GTFGYVDPMY AENSILTKES DVYSFGVVLF EVLCGRLCFE INDGDHFQCL  240
VRTWKQSYKQ KKLDEIIFQD LKQYIDPRSL EIFSAIAYQC LQKYREARPT MSHIVEYLGI  300
ALRLQEIFEK VGQPMNFEEM IKIEVSKGKL KMLLSRQGML INGGKMGIGV AKSIVETPTS  360
VPQKEKPLKC PRCDSTNTKF CYYNNYSLTQ PRHFCKSCRR YWTLNGSLRN VRVGGGSRKP  420
KRPFQDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2qkw_B2e-67330619318Protein kinase
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XIV21e-156A0A103XIV2_CYNCS; Phloem protein 2-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-29OBF-binding protein 3